SUPT5H Antibody (3B1)

Images

 
Western Blot: SUPT5H Antibody (3B1) [H00006829-M03] - Analysis of SUPT5H expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: SUPT5H Antibody (3B1) [H00006829-M03] - Analysis of monoclonal antibody to SUPT5H on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SUPT5H Antibody (3B1) Summary

Immunogen
SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
Specificity
SUPT5H (3B1)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SUPT5H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUPT5H Antibody (3B1)

  • DRB sensitivity-inducing factor 160 kDa subunit
  • DRB sensitivity-inducing factor large subunit
  • DSIF large subunit
  • DSIF p160
  • FLJ34157
  • SPT5hSPT5
  • SPT5HTat-cotransactivator 1 protein
  • suppressor of Ty (S.cerevisiae) 5 homolog
  • suppressor of Ty 5 homolog (S. cerevisiae)
  • Tat-CT1 protein
  • Tat-CT1
  • transcription elongation factor SPT5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP, KD
NBP2-67811
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-81759
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-03306
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-95202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-94643
Species: Hu, Mu, Rt
Applications: WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-273
Species: Hu, Mu
Applications: WB, IP
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUPT5H Antibody (H00006829-M03) (0)

There are no publications for SUPT5H Antibody (H00006829-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUPT5H Antibody (H00006829-M03) (0)

There are no reviews for SUPT5H Antibody (H00006829-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUPT5H Antibody (H00006829-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUPT5H Products

Array H00006829-M03

Bioinformatics Tool for SUPT5H Antibody (H00006829-M03)

Discover related pathways, diseases and genes to SUPT5H Antibody (H00006829-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUPT5H Antibody (H00006829-M03)

Discover more about diseases related to SUPT5H Antibody (H00006829-M03).
 

Pathways for SUPT5H Antibody (H00006829-M03)

View related products by pathway.

PTMs for SUPT5H Antibody (H00006829-M03)

Learn more about PTMs related to SUPT5H Antibody (H00006829-M03).

Blogs on SUPT5H

There are no specific blogs for SUPT5H, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUPT5H Antibody (3B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SUPT5H
Entrez
OMIM
Uniprot