Recombinant Human STYXL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STYXL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-313 of Human DUSP24 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STYXL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STYXL1 Protein

  • dual specificity phosphatase 24 (putative)
  • Dual specificity phosphatase inhibitor MK-STYX
  • Dual specificity protein phosphatase 24
  • DUSP24
  • Map kinase phosphatase-like protein MK-STYX
  • MKSTYX
  • MK-STYX
  • serine/threonine/tyrosine interacting-like 1
  • serine/threonine/tyrosine-interacting-like protein 1

Background

DUSP24( AAH24035, 1 a.a. - 314 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5809
Species: Hu
Applications: WB
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB8526
Species: Mu
Applications: IHC
AF486
Species: Mu
Applications: WB, IHC, Neut
MAB5628
Species: Hu, Mu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051657-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for STYXL1 Recombinant Protein (H00051657-P01) (0)

There are no publications for STYXL1 Recombinant Protein (H00051657-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STYXL1 Recombinant Protein (H00051657-P01) (0)

There are no reviews for STYXL1 Recombinant Protein (H00051657-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STYXL1 Recombinant Protein (H00051657-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STYXL1 Products

Bioinformatics Tool for STYXL1 Recombinant Protein (H00051657-P01)

Discover related pathways, diseases and genes to STYXL1 Recombinant Protein (H00051657-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STYXL1 Recombinant Protein (H00051657-P01)

Discover more about diseases related to STYXL1 Recombinant Protein (H00051657-P01).
 

Pathways for STYXL1 Recombinant Protein (H00051657-P01)

View related products by pathway.

Research Areas for STYXL1 Recombinant Protein (H00051657-P01)

Find related products by research area.

Blogs on STYXL1

There are no specific blogs for STYXL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STYXL1 Antibody
NBP2-47611
BID Antibody
NB100-56106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STYXL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STYXL1