STK4 Recombinant Protein Antigen

Images

 
There are currently no images for STK4 Protein (NBP1-82865PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STK4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK4.

Source: E.coli

Amino Acid Sequence: IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82865.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STK4 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • kinase responsive to stress 2
  • KRS2KRS2))
  • Mammalian STE20-like protein kinase 1
  • mammalian sterile 20-like 1
  • MST-1
  • MST1DKFZp686A2068
  • serine/threonine kinase 4
  • serine/threonine-protein kinase 4
  • Serine/threonine-protein kinase Krs-2
  • STE20-like kinase MST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF5066
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NB200-197
Species: Hu, Mu
Applications: WB, IP
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-66121
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-82865PEP
Species: Hu
Applications: AC

Publications for STK4 Protein (NBP1-82865PEP) (0)

There are no publications for STK4 Protein (NBP1-82865PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK4 Protein (NBP1-82865PEP) (0)

There are no reviews for STK4 Protein (NBP1-82865PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for STK4 Protein (NBP1-82865PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for STK4 Protein (NBP1-82865PEP)

Discover related pathways, diseases and genes to STK4 Protein (NBP1-82865PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK4 Protein (NBP1-82865PEP)

Discover more about diseases related to STK4 Protein (NBP1-82865PEP).
 

Pathways for STK4 Protein (NBP1-82865PEP)

View related products by pathway.

PTMs for STK4 Protein (NBP1-82865PEP)

Learn more about PTMs related to STK4 Protein (NBP1-82865PEP).
 

Research Areas for STK4 Protein (NBP1-82865PEP)

Find related products by research area.

Blogs on STK4

There are no specific blogs for STK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STK4 Antibody
NBP1-82865
YAP1 Antibody
NB110-58358

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK4