STK22C Antibody (6H4)

Images

 
Sandwich ELISA: STK22C Antibody (6H4) [H00081629-M06] - Detection limit for recombinant GST tagged TSSK3 is 3 ng/ml as a capture antibody.
Immunoprecipitation: STK22C Antibody (6H4) [H00081629-M06] - Analysis of TSSK3 transfected lysate using anti-TSSK3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TSSK3 rabbit polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
6H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STK22C Antibody (6H4) Summary

Immunogen
TSSK3 (AAH35354, 1 a.a. ~ 269 a.a) full length recombinant protein with GST tag.MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVID KMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKI CLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCH GCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSHRELSQT FCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRL
Specificity
TSSK3 - testis-specific serine kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TSSK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK22C Antibody (6H4)

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 22C (spermiogenesis associated)
  • Serine/threonine-protein kinase 22C
  • SPOGA3TSK3
  • STK22Cspermiogenesis associated 3
  • STK22D
  • Testis-specific kinase 3
  • testis-specific serine kinase 3
  • testis-specific serine/threonine kinase 22C
  • testis-specific serine/threonine-protein kinase 3
  • TSK-3
  • TSSK-3

Background

This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00083942-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00023617-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00083983-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058524-R01
Species: Hu
H00010420-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56284
Species: Hu
Applications: WB, ICC/IF
NBP1-90195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
MAB4449
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for STK22C Antibody (H00081629-M06) (0)

There are no publications for STK22C Antibody (H00081629-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK22C Antibody (H00081629-M06) (0)

There are no reviews for STK22C Antibody (H00081629-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STK22C Antibody (H00081629-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK22C Products

Bioinformatics Tool for STK22C Antibody (H00081629-M06)

Discover related pathways, diseases and genes to STK22C Antibody (H00081629-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK22C Antibody (H00081629-M06)

Discover more about diseases related to STK22C Antibody (H00081629-M06).
 

Pathways for STK22C Antibody (H00081629-M06)

View related products by pathway.

PTMs for STK22C Antibody (H00081629-M06)

Learn more about PTMs related to STK22C Antibody (H00081629-M06).
 

Research Areas for STK22C Antibody (H00081629-M06)

Find related products by research area.

Blogs on STK22C

There are no specific blogs for STK22C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK22C Antibody (6H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TSSK3
Entrez
OMIM
Uniprot