ST5 Antibody (1A3)

Images

 
There are currently no images for ST5 Antibody (H00006764-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ST5 Antibody (1A3) Summary

Immunogen
ST5 (NP_005409 1038 a.a. - 1135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK
Specificity
ST5 - suppression of tumorigenicity 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ST5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ST5 Antibody (1A3)

  • DENN domain-containing protein 2B
  • DENND2BDENN/MADD domain containing 2B
  • HeLa tumor suppression 1
  • HTS1MGC33090
  • p126
  • suppression of tumorigenicity 5 protein
  • suppression of tumorigenicity 5

Background

This gene was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein encoded by this gene contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Three alternatively spliced transcript variants of this gene encoding distinct isoforms are identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006386-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF2560
Species: Hu
Applications: WB
NBP1-84771
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
NBP2-13464
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP1-77148
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
H00006764-M01
Species: Hu
Applications: ELISA

Publications for ST5 Antibody (H00006764-M01) (0)

There are no publications for ST5 Antibody (H00006764-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST5 Antibody (H00006764-M01) (0)

There are no reviews for ST5 Antibody (H00006764-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ST5 Antibody (H00006764-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST5 Products

Bioinformatics Tool for ST5 Antibody (H00006764-M01)

Discover related pathways, diseases and genes to ST5 Antibody (H00006764-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST5 Antibody (H00006764-M01)

Discover more about diseases related to ST5 Antibody (H00006764-M01).
 

Pathways for ST5 Antibody (H00006764-M01)

View related products by pathway.

PTMs for ST5 Antibody (H00006764-M01)

Learn more about PTMs related to ST5 Antibody (H00006764-M01).

Blogs on ST5

There are no specific blogs for ST5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST5 Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ST5
Entrez
OMIM
Uniprot