ST5 Antibody (1A3)

Product Discontinued

ST5 Antibody (1A3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ST5 (NP_005409, 1038 a.a. ~ 1135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK
• Specificity: ST5 - suppression of tumorigenicity 5
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ST5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ST5 Antibody (1A3)

• DENN domain-containing protein 2B
• DENND2BDENN/MADD domain containing 2B
• HeLa tumor suppression 1
• HTS1MGC33090
• p126
• suppression of tumorigenicity 5 protein
• suppression of tumorigenicity 5

Background

This gene was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein encoded by this gene contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Three alternatively spliced transcript variants of this gene encoding distinct isoforms are identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST5
• Entrez:
  • 6764(Human)
• OMIM:
  • 140750(Human)
• Uniprot:
  • NP_005409(Human)