SSX4 Antibody

Images

 
Western Blot: SSX4 Antibody [NBP2-86832] - WB Suggested Anti-SSX4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Placenta

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSX4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SSX4. Peptide sequence: NGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SSX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSX4 Antibody

  • Cancer/testis antigen 5.4
  • CT5.4SSX4B
  • MGC119056
  • MGC12411
  • protein SSX4
  • SSX4A
  • synovial sarcoma, X breakpoint 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
H00006760-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-00614
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-74372
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00010214-P01
Species: Hu
Applications: ELISA, AP, IHC, IHC-P, PA, PAGE, WB
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-85397
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-80294
Species: Hu
Applications: IHC, IHC-P, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-45500
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SSX4 Antibody (NBP2-86832) (0)

There are no publications for SSX4 Antibody (NBP2-86832).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSX4 Antibody (NBP2-86832) (0)

There are no reviews for SSX4 Antibody (NBP2-86832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSX4 Antibody (NBP2-86832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSX4 Products

Bioinformatics Tool for SSX4 Antibody (NBP2-86832)

Discover related pathways, diseases and genes to SSX4 Antibody (NBP2-86832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSX4 Antibody (NBP2-86832)

Discover more about diseases related to SSX4 Antibody (NBP2-86832).
 

Pathways for SSX4 Antibody (NBP2-86832)

View related products by pathway.

PTMs for SSX4 Antibody (NBP2-86832)

Learn more about PTMs related to SSX4 Antibody (NBP2-86832).
 

Research Areas for SSX4 Antibody (NBP2-86832)

Find related products by research area.

Blogs on SSX4

There are no specific blogs for SSX4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSX4