SRP54 Antibody (2G7)

Images

 
Sandwich ELISA: SRP54 Antibody (2G7) [H00006729-M01] - Detection limit for recombinant GST tagged SRP54 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SRP54 Antibody (2G7) Summary

Immunogen
SRP54 (NP_003127.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK
Specificity
SRP54 - signal recognition particle 54kDa (2G7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRP54
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRP54 Antibody (2G7)

  • signal recognition particle 54 kDa protein
  • signal recognition particle 54kD
  • signal recognition particle 54kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89507
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-89498
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89532
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61107
Species: Hu
Applications: WB, IP
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00006729-M01
Species: Hu
Applications: WB, ELISA

Publications for SRP54 Antibody (H00006729-M01) (0)

There are no publications for SRP54 Antibody (H00006729-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRP54 Antibody (H00006729-M01) (0)

There are no reviews for SRP54 Antibody (H00006729-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRP54 Antibody (H00006729-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRP54 Products

Bioinformatics Tool for SRP54 Antibody (H00006729-M01)

Discover related pathways, diseases and genes to SRP54 Antibody (H00006729-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRP54 Antibody (H00006729-M01)

Discover more about diseases related to SRP54 Antibody (H00006729-M01).
 

Pathways for SRP54 Antibody (H00006729-M01)

View related products by pathway.

PTMs for SRP54 Antibody (H00006729-M01)

Learn more about PTMs related to SRP54 Antibody (H00006729-M01).
 

Research Areas for SRP54 Antibody (H00006729-M01)

Find related products by research area.

Blogs on SRP54

There are no specific blogs for SRP54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRP54 Antibody (2G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SRP54
Entrez
Uniprot