SREB3 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human GPR173 (NP_061842.1). FDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR173 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for SREB3 Antibody - Azide and BSA Free
Background
SREB3, a member of the SREB (Super-Conserved Receptor Expressed in Brain) family of GPCRs, is an Orphan-A GPCR with an unknown ligand. SREB3 has been reported to be expressed in several areas of human and rat CNS (Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from lung libraries, as well as cancer libraries of the brain, colon, and lung.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bt, Bv, Ca, Ch, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ze
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SREB3 Antibody (NBP2-93961) (0)
There are no publications for SREB3 Antibody (NBP2-93961).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SREB3 Antibody (NBP2-93961) (0)
There are no reviews for SREB3 Antibody (NBP2-93961).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SREB3 Antibody (NBP2-93961) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SREB3 Products
Research Areas for SREB3 Antibody (NBP2-93961)
Find related products by research area.
|
Blogs on SREB3