SREB3 Antibody - Azide and BSA Free

Western Blot: SREB3 Antibody [NBP2-93961] - Analysis of extracts of various cell lines, using SREB3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SREB3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SREB3 Antibody - Azide and BSA Free (NBP2-93961) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human GPR173 (NP_061842.1). FDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPVQMVPAISQNW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR173
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SREB3 Antibody - Azide and BSA Free

• G protein coupled receptor 173
• G protein-coupled receptor 173
• G-protein coupled receptor 173
• probable G-protein coupled receptor 173
• SREB3Super conserved receptor expressed in brain 3

Background

SREB3, a member of the SREB (Super-Conserved Receptor Expressed in Brain) family of GPCRs, is an Orphan-A GPCR with an unknown ligand. SREB3 has been reported to be expressed in several areas of human and rat CNS (Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from lung libraries, as well as cancer libraries of the brain, colon, and lung.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GPR173