SR140 Antibody

Images

 
Western Blot: SR140 Antibody [NBP1-70714] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SR140 Antibody Summary

Immunogen
Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the middle region of SR140. Peptide sequence KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2SURP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SR140 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SR140 Antibody

  • 140 kDa Ser/Arg-rich domain protein
  • fSAPa
  • KIAA0332
  • SR140
  • U2 snRNP-associated SURP domain containing
  • U2 snRNP-associated SURP motif-containing protein
  • U2-associated protein SR140

Background

The specific function of SR140 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB300-102
Species: Mu, Rt, GP, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
MAB4077
Species: Hu
Applications: WB, IHC

Publications for SR140 Antibody (NBP1-70714) (0)

There are no publications for SR140 Antibody (NBP1-70714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR140 Antibody (NBP1-70714) (0)

There are no reviews for SR140 Antibody (NBP1-70714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR140 Antibody (NBP1-70714). (Showing 1 - 1 of 1 FAQ).

  1. I purchased a vial of SR140 antibody (NBP1-70714) and prepared a solution of 1:500 in 5% milk which I stored at -20 degrees Delsius. At first it worked properly but after a couple of uses it stopped identifying the protein and started staining the marker. I prepared a new solution in the same way and it happened exactly the same. I decided to purchase a new vial of the exact same antibody and did the same with the identical result. Is there a solution for this? Why does the antibody stop working after some uses?
    • Am I correct in understanding that you are diluting the antibody in your blocking buffer and then storing it at -20 degrees Celsius between uses? This most likely problem here is that by putting the antibody through multiple freeze-thaw cycles, it is getting degraded. You should aliquot your stock solution and store it at -20, but your working solution should be stored at 4 degrees Celsius so the antibody isn't undergoing multiple freeze-thaw cycles.

Secondary Antibodies

 

Isotype Controls

Additional SR140 Products

SR140 NBP1-70714

Bioinformatics Tool for SR140 Antibody (NBP1-70714)

Discover related pathways, diseases and genes to SR140 Antibody (NBP1-70714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SR140

There are no specific blogs for SR140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR140 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol U2SURP