SR140 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the middle region of SR140.
Peptide sequence KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
U2SURP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SR140 Antibody - BSA Free
Background
The specific function of SR140 is not yet known.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC
Species: Gp, Hu(-), Mu, Rt, Sh
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB (-)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Publications for SR140 Antibody (NBP1-70714) (0)
There are no publications for SR140 Antibody (NBP1-70714).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SR140 Antibody (NBP1-70714) (0)
There are no reviews for SR140 Antibody (NBP1-70714).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SR140 Antibody (NBP1-70714). (Showing 1 - 1 of 1 FAQ).
-
I purchased a vial of SR140 antibody (NBP1-70714) and prepared a solution of 1:500 in 5% milk which I stored at -20 degrees Delsius. At first it worked properly but after a couple of uses it stopped identifying the protein and started staining the marker. I prepared a new solution in the same way and it happened exactly the same. I decided to purchase a new vial of the exact same antibody and did the same with the identical result. Is there a solution for this? Why does the antibody stop working after some uses?
- Am I correct in understanding that you are diluting the antibody in your blocking buffer and then storing it at -20 degrees Celsius between uses? This most likely problem here is that by putting the antibody through multiple freeze-thaw cycles, it is getting degraded. You should aliquot your stock solution and store it at -20, but your working solution should be stored at 4 degrees Celsius so the antibody isn't undergoing multiple freeze-thaw cycles.
Secondary Antibodies
| |
Isotype Controls
|
Additional SR140 Products
Blogs on SR140