SR140 Antibody


Western Blot: SR140 Antibody [NBP1-70714] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

SR140 Antibody Summary

Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the middle region of SR140. Peptide sequence KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against SR140 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SR140 Antibody

  • 140 kDa Ser/Arg-rich domain protein
  • fSAPa
  • KIAA0332
  • SR140
  • U2 snRNP-associated SURP domain containing
  • U2 snRNP-associated SURP motif-containing protein
  • U2-associated protein SR140


The specific function of SR140 is not yet known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr
Species: Mu, Rt, GP, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: Func, PAGE
Species: Hu
Applications: WB

Publications for SR140 Antibody (NBP1-70714) (0)

There are no publications for SR140 Antibody (NBP1-70714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR140 Antibody (NBP1-70714) (0)

There are no reviews for SR140 Antibody (NBP1-70714). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR140 Antibody (NBP1-70714). (Showing 1 - 1 of 1 FAQ).

  1. I purchased a vial of SR140 antibody (NBP1-70714) and prepared a solution of 1:500 in 5% milk which I stored at -20 degrees Delsius. At first it worked properly but after a couple of uses it stopped identifying the protein and started staining the marker. I prepared a new solution in the same way and it happened exactly the same. I decided to purchase a new vial of the exact same antibody and did the same with the identical result. Is there a solution for this? Why does the antibody stop working after some uses?
    • Am I correct in understanding that you are diluting the antibody in your blocking buffer and then storing it at -20 degrees Celsius between uses? This most likely problem here is that by putting the antibody through multiple freeze-thaw cycles, it is getting degraded. You should aliquot your stock solution and store it at -20, but your working solution should be stored at 4 degrees Celsius so the antibody isn't undergoing multiple freeze-thaw cycles.

Secondary Antibodies


Isotype Controls

Additional SR140 Antibody Products

SR140 NBP1-70714

Related Products by Gene

Bioinformatics Tool for SR140 Antibody (NBP1-70714)

Discover related pathways, diseases and genes to SR140 Antibody (NBP1-70714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SR140

There are no specific blogs for SR140, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol U2SURP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70714 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought