SPINT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-SPINT4 antibody. Corresponding SPINT4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Staining of human endometrium shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPINT4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPINT4 Antibody - BSA Free (NBP2-62613) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPINT4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPINT4 Recombinant Protein Antigen (NBP2-62613PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for SPINT4 Antibody - BSA Free

• C20orf137
• Chromosome 20 Open Reading Frame 137
• DJ601O1.1
• Kunitz-Type Protease Inhibitor 4
• Serine Peptidase Inhibitor, Kunitz Type 4
• Serine Protease Inhibitor, Kunitz Type 4
• SPINT3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for SPINT4 Antibody (NBP2-62613) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Charlotte Dietzel ICC Human 05/10/2023

Summary

• Application: Immunocytochemistry
• Sample Tested: plasmid transfected HEK293T cells
• Species: Human
• Lot: R43780

Comments

• Comments: Overview/Application Description: The specificity and signal/noise ratio of the anti-SPINT4 antibody was tested in immunofluorescence staining analyses of Human HEK293T cells expressing the SPINT4-HA protein. Signal seems to be non-specific (based on the degree of overlap of the SPINT4 and HA signal) with high background (based on the presence of signal in untransfected cells).
  
  Procedural Details: HEK293T cells were transfected with an expression plasmid encoding the SPINT4 protein fused to a C-terminal HA epitope (SPINT4-HA). Cells were fixed in 1.5% paraformaldehyde at room temperature, permeabilized with 0.5% Triton-X on ice, blocked using 10% fetal bovine serum in PBS and incubated with rabbit anti-SPINT4 antibodies (1:200 dilution) and with mouse anti-HA antibodies (1:200 dilution) for one hour at room temperature. Samples were washed with blocking buffer and incubated with Alexa Fluor 594-conjugated goat anti-rabbit antibodies (1:200 dilution) and with Alexa Fluor 488-conjugated goat anti-mouse antibodies (1:200 dilution) for one hour at room temperature, prior to washing in PBS and highlighting of nuclear DNA using Hoechst33342 for three minutes. Untransfected cells processed in the same way were used as controls. Coverslips were then mounted, and signal was visualized using a fluorescence microscope.

Bioinformatics

• Gene Symbol: SPINT4