SPDYC Antibody

Images

 
Western Blot: SPDYC Antibody [NBP2-83583] - Host: Rabbit. Target Name: SPDYC. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPDYC Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPDYC. Peptide sequence: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SPDYC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPDYC Antibody

  • hSpy/Ringo C
  • Rapid inducer of G2/M progression in oocytes C
  • RINGO C
  • Ringo2
  • speedy C
  • speedy homolog C (Xenopus laevis)
  • speedy protein C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-97478
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-2521
Species: Hu, Mu, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83583
Species: Hu
Applications: WB

Publications for SPDYC Antibody (NBP2-83583) (0)

There are no publications for SPDYC Antibody (NBP2-83583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDYC Antibody (NBP2-83583) (0)

There are no reviews for SPDYC Antibody (NBP2-83583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDYC Antibody (NBP2-83583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPDYC Products

Bioinformatics Tool for SPDYC Antibody (NBP2-83583)

Discover related pathways, diseases and genes to SPDYC Antibody (NBP2-83583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPDYC

There are no specific blogs for SPDYC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDYC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDYC