Recombinant Human SPC18 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SPC18 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-179 of Human SEC11L1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SEC11A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPC18 GST (N-Term) Protein

  • EC 3.4
  • Endopeptidase SP18
  • Microsomal signal peptidase 18 kDa subunit
  • SEC11 homolog A (S. cerevisiae)
  • SEC11 homolog A
  • SEC11L1
  • SEC11-like 1
  • SEC11-like protein 1
  • sid2895
  • signal peptidase complex (18kD)
  • signal peptidase complex catalytic subunit SEC11A
  • SPase 18 kDa subunit
  • SPC18SEC11-like 1 (S. cerevisiae)
  • SPCS4A1810012E07Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80774
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1379
Species: Hu
Applications: WB, IHC
NBP1-92433
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30884
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single-Cell Western
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB1032
Species: Hu
Applications: WB, IHC
NB100-93444
Species: Hu
Applications: WB, PEP-ELISA
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-32002
Species: Hu
Applications: IHC, IHC-P
NBP2-14870
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-06103
Species: Hu
Applications: IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
MAB4077
Species: Hu
Applications: WB, IHC
AF4274
Species: Mu
Applications: WB, IHC

Publications for SPC18 Recombinant Protein (H00023478-P01) (0)

There are no publications for SPC18 Recombinant Protein (H00023478-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPC18 Recombinant Protein (H00023478-P01) (0)

There are no reviews for SPC18 Recombinant Protein (H00023478-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPC18 Recombinant Protein (H00023478-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SPC18 Products

Bioinformatics Tool for SPC18 Recombinant Protein (H00023478-P01)

Discover related pathways, diseases and genes to SPC18 Recombinant Protein (H00023478-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for SPC18 Recombinant Protein (H00023478-P01)

Learn more about PTMs related to SPC18 Recombinant Protein (H00023478-P01).

Blogs on SPC18

There are no specific blogs for SPC18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPC18 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC11A