Recombinant Human SPANXA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPANXA1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 97 of Human SPANXA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPANXA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPANXA1 Protein

  • B1
  • C
  • cancer/testis antigen family 11, member 1
  • CT11.1
  • CT11.2
  • CT11.3
  • CT11.4
  • CTp11
  • dJ171K16.1
  • member A1
  • NAP-X
  • nuclear-associated protein SPAN-Xa
  • SPANX family member A
  • SPANX
  • SPAN-X
  • SPANXA
  • SPAN-Xa
  • SPANX-A
  • SPANXA1 sperm protein associated with the nucleus, X-linked, family member A1
  • SPANXA2
  • SPANX-A2
  • SPANXB
  • SPAN-Xb
  • SPANX-B
  • SPANXC
  • SPANX-C
  • SPANXD
  • SPANX-D
  • sperm protein associated with the nucleus on the X chromosome A
  • sperm protein associated with the nucleus, X chromosome, family member A1
  • sperm protein associated with the nucleus, X-linked, family member A1

Background

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-head orientation with SPANX family member A2, which appears to be a duplication of the A1 locus. The protein encoded by this gene targets to the nucleus where it associates with nuclear vacuoles and the redundant nuclear envelope. Based on its association with these poorly characterized regions of the sperm nucleus, this protein provides a biochemical marker to study unique structures in spermatazoa while attempting to further define its role in spermatogenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-03285
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-84355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00058524-R01
Species: Hu
H00030014-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPANXA1 Recombinant Protein (H00030014-P01) (0)

There are no publications for SPANXA1 Recombinant Protein (H00030014-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPANXA1 Recombinant Protein (H00030014-P01) (0)

There are no reviews for SPANXA1 Recombinant Protein (H00030014-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPANXA1 Recombinant Protein (H00030014-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPANXA1 Products

SPANXA1 H00030014-P01

Bioinformatics Tool for SPANXA1 Recombinant Protein (H00030014-P01)

Discover related pathways, diseases and genes to SPANXA1 Recombinant Protein (H00030014-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPANXA1 Recombinant Protein (H00030014-P01)

Discover more about diseases related to SPANXA1 Recombinant Protein (H00030014-P01).
 

Pathways for SPANXA1 Recombinant Protein (H00030014-P01)

View related products by pathway.

PTMs for SPANXA1 Recombinant Protein (H00030014-P01)

Learn more about PTMs related to SPANXA1 Recombinant Protein (H00030014-P01).

Blogs on SPANXA1

There are no specific blogs for SPANXA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF [Unconjugated]
215-GM-010/CF
IL-7 [Unconjugated]
207-IL-005/CF
MeCP2 Antibody
NB100-56326

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPANXA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPANXA1