Recombinant Human SNX4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SNX4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 341-450 of Human SNX4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM

Protein/Peptide Type
Partial Recombinant Protein
Gene
SNX4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNX4 Protein

  • ATG24B
  • sorting nexin 4
  • sorting nexin-4

Background

SNX4 - sorting nexin 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NBP1-92052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89485
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-58645
Species: Hu
Applications: WB, ICC/IF

Publications for SNX4 Partial Recombinant Protein (H00008723-Q01) (0)

There are no publications for SNX4 Partial Recombinant Protein (H00008723-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX4 Partial Recombinant Protein (H00008723-Q01) (0)

There are no reviews for SNX4 Partial Recombinant Protein (H00008723-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX4 Partial Recombinant Protein (H00008723-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNX4 Products

Bioinformatics Tool for SNX4 Partial Recombinant Protein (H00008723-Q01)

Discover related pathways, diseases and genes to SNX4 Partial Recombinant Protein (H00008723-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX4 Partial Recombinant Protein (H00008723-Q01)

Discover more about diseases related to SNX4 Partial Recombinant Protein (H00008723-Q01).
 

Pathways for SNX4 Partial Recombinant Protein (H00008723-Q01)

View related products by pathway.

PTMs for SNX4 Partial Recombinant Protein (H00008723-Q01)

Learn more about PTMs related to SNX4 Partial Recombinant Protein (H00008723-Q01).

Blogs on SNX4

There are no specific blogs for SNX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SNX4 Antibody
NBP1-88882
VPS35 Antibody
NB100-1397

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNX4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX4