Recombinant Human SNX33 Protein

Images

 
Western Blot: SNX33 Partial Recombinant Protein [h00257364-Q01]
SDS-Page: SNX33 Partial Recombinant Protein [h00257364-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SNX33 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 475-574 of Human SNX33

Source: Wheat Germ

Amino Acid Sequence: YQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SNX33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNX33 Protein

  • MGC32065
  • SH3 and PX domain containing 3
  • SH3PXD3CSH3PX3
  • SNX30SH3 and PX domain-containing protein 3
  • sorting nexin 33
  • sorting nexin-33

Background

SH3PX3 - hypothetical protein MGC32065

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NB100-2307
Species: Hu
Applications: WB
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
H00004867-D01P
Species: Hu, Mu
Applications: WB
NBP2-20443
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66813
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
H00079092-Q01
Species: Hu
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for SNX33 Partial Recombinant Protein (H00257364-Q01) (0)

There are no publications for SNX33 Partial Recombinant Protein (H00257364-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX33 Partial Recombinant Protein (H00257364-Q01) (0)

There are no reviews for SNX33 Partial Recombinant Protein (H00257364-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX33 Partial Recombinant Protein (H00257364-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SNX33 Partial Recombinant Protein (H00257364-Q01)

Discover related pathways, diseases and genes to SNX33 Partial Recombinant Protein (H00257364-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX33 Partial Recombinant Protein (H00257364-Q01)

Discover more about diseases related to SNX33 Partial Recombinant Protein (H00257364-Q01).
 

Pathways for SNX33 Partial Recombinant Protein (H00257364-Q01)

View related products by pathway.

PTMs for SNX33 Partial Recombinant Protein (H00257364-Q01)

Learn more about PTMs related to SNX33 Partial Recombinant Protein (H00257364-Q01).
 

Research Areas for SNX33 Partial Recombinant Protein (H00257364-Q01)

Find related products by research area.

Blogs on SNX33

There are no specific blogs for SNX33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SNX33 Antibody
H00257364-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNX33 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX33