SNRPB Antibody (1B4) - Azide and BSA Free

Sandwich ELISA: SNRPB Antibody (1B4) [H00006628-M01] - Detection limit for recombinant GST tagged SNRPB is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SNRPB Antibody (1B4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SNRPB (NP_003082, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SNRPB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNRPB Antibody (1B4) - Azide and BSA Free

• CODB polypeptide of Sm protein
• Sm protein B/B'
• small nuclear ribonucleoprotein polypeptides B and B'
• small nuclear ribonucleoprotein polypeptides B and B1
• small nuclear ribonucleoprotein-associated proteins B and B'
• SmB/B'
• Sm-B/B'sm-B/Sm-B'
• SmB/SmB'
• snRNP-Bsmall nuclear ribonucleoprotein polypeptide B
• SNRPB1

Background

SNRPB is encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPB
• Uniprot:
  • NP_003082(Human)