Snapin Antibody

Images

 
Western Blot: Snapin Antibody [H00023557-B01P] - Analysis of SNAPIN expression in transfected 293T cell line by SNAPIN polyclonal antibody. Lane 1: SNAPAP transfected lysate(14.96 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Snapin Antibody Summary

Immunogen
SNAPIN (AAH04494, 1 a.a. - 136 a.a.) full-length human protein. MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Specificity
SNAPIN - SNAP-associated protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SNAPIN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate for western blot and recombinant protein with GST tag for ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Snapin Antibody

  • SNAP-25-binding protein
  • SNAP25BP
  • SNAPAP
  • SNAPAPSNARE-associated protein Snapin
  • SNAP-associated proteinSNARE associated protein snapin
  • Snapin
  • Synaptosomal-associated protein 25-binding protein

Background

SNAPAP is a component of the SNARE complex of proteins that is required for synaptic vesicle docking and fusion (Ilardi et al., 1999 [PubMed 10195194]). SNAPAP is also a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85299
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
AF4965
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-89162
Species: At, Pl
Applications: IHC, IHC-P, WB
NBP1-19091
Species: Hu, Mu
Applications: IP, WB
NBP1-87525
Species: Hu
Applications: IHC, IHC-P, WB
H00148327-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, PLA, WB
NBP3-12233
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-05039
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for Snapin Antibody (H00023557-B01P) (0)

There are no publications for Snapin Antibody (H00023557-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Snapin Antibody (H00023557-B01P) (0)

There are no reviews for Snapin Antibody (H00023557-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Snapin Antibody (H00023557-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Snapin Products

Bioinformatics Tool for Snapin Antibody (H00023557-B01P)

Discover related pathways, diseases and genes to Snapin Antibody (H00023557-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Snapin Antibody (H00023557-B01P)

Discover more about diseases related to Snapin Antibody (H00023557-B01P).
 

Pathways for Snapin Antibody (H00023557-B01P)

View related products by pathway.

PTMs for Snapin Antibody (H00023557-B01P)

Learn more about PTMs related to Snapin Antibody (H00023557-B01P).
 

Research Areas for Snapin Antibody (H00023557-B01P)

Find related products by research area.

Blogs on Snapin

There are no specific blogs for Snapin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Snapin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAPIN
Entrez
Uniprot