Recombinant Human SNAP29 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SNAP29 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 118-245 of Human SNAP29 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SNAP29
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNAP29 Protein

  • CEDNIK
  • CEDNIKSoluble 29 kDa NSF attachment protein
  • SNAP29
  • SNAP-29FLJ21051
  • synaptosomal-associated protein 29
  • synaptosomal-associated protein, 29kD
  • synaptosomal-associated protein, 29kDa
  • Vesicle-membrane fusion protein SNAP-29

Background

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88483
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
AF5354
Species: Hu
Applications: WB, IHC
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45925
Species: Hu, Mu, Ca
Applications: WB, IF

Publications for SNAP29 Partial Recombinant Protein (H00009342-Q01) (0)

There are no publications for SNAP29 Partial Recombinant Protein (H00009342-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP29 Partial Recombinant Protein (H00009342-Q01) (0)

There are no reviews for SNAP29 Partial Recombinant Protein (H00009342-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAP29 Partial Recombinant Protein (H00009342-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNAP29 Products

Bioinformatics Tool for SNAP29 Partial Recombinant Protein (H00009342-Q01)

Discover related pathways, diseases and genes to SNAP29 Partial Recombinant Protein (H00009342-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAP29 Partial Recombinant Protein (H00009342-Q01)

Discover more about diseases related to SNAP29 Partial Recombinant Protein (H00009342-Q01).
 

Pathways for SNAP29 Partial Recombinant Protein (H00009342-Q01)

View related products by pathway.

PTMs for SNAP29 Partial Recombinant Protein (H00009342-Q01)

Learn more about PTMs related to SNAP29 Partial Recombinant Protein (H00009342-Q01).
 

Research Areas for SNAP29 Partial Recombinant Protein (H00009342-Q01)

Find related products by research area.

Blogs on SNAP29

There are no specific blogs for SNAP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNAP29 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAP29
Entrez