Recombinant Human SMA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-140 of Human SMA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SMA4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMA4 Protein

  • b55C20.2
  • FLJ36702
  • FLJ39772
  • glucuronidase, beta pseudogene
  • MGC22265
  • MGC60382
  • SMA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB829
Species: Hu
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83167
Species: Hu
Applications: WB, IHC, IHC-P
AF1120
Species: Mu
Applications: WB, IHC
H00001632-D01P
Species: Hu, Mu
Applications: WB
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-19634
Species: Hu
Applications: WB, ICC/IF
NBP2-38161
Species: Hu
Applications: IHC, IHC-P
NBP2-33609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
AF2390
Species: Hu
Applications: WB, Simple Western
NBP2-58068
Species: Hu
Applications: ICC/IF, IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
H00011039-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for SMA4 Recombinant Protein (H00011039-P02) (0)

There are no publications for SMA4 Recombinant Protein (H00011039-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMA4 Recombinant Protein (H00011039-P02) (0)

There are no reviews for SMA4 Recombinant Protein (H00011039-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMA4 Recombinant Protein (H00011039-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMA4 Products

Bioinformatics Tool for SMA4 Recombinant Protein (H00011039-P02)

Discover related pathways, diseases and genes to SMA4 Recombinant Protein (H00011039-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMA4 Recombinant Protein (H00011039-P02)

Discover more about diseases related to SMA4 Recombinant Protein (H00011039-P02).
 

Pathways for SMA4 Recombinant Protein (H00011039-P02)

View related products by pathway.

Research Areas for SMA4 Recombinant Protein (H00011039-P02)

Find related products by research area.

Blogs on SMA4

There are no specific blogs for SMA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMA4 Antibody
H00011039-B01P
PER2 Antibody
NB100-125

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMA4