SLC9A7 Recombinant Protein Antigen

Images

 
There are currently no images for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC9A7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC9A7.

Source: E. coli

Amino Acid Sequence: SWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC9A7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57956.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC9A7 Recombinant Protein Antigen

  • Na(+)/H(+) exchanger 7
  • NHE7
  • NHE-7
  • NHE7SLC9A6
  • nonselective sodium potassium/proton exchanger
  • SLC9A7
  • sodium/hydrogen exchanger 7
  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), isoform 7
  • solute carrier family 9 (sodium/hydrogen exchanger), member 7
  • Solute carrier family 9 member 7

Background

Na+/H+ exchangers (NHE) of mammalian cells are plasma membrane intrinsic proteins mediating exchange of N+ and H+ ions in various tissues. The NHE catalyzes the electroneural transport of extracellular Na+ for intracellular H+. They play a major role in regulation of intracellular pH (pHi) in addition to trans-cellular absorption of Na+, cell volume regulation and possibly in cell proliferation. These primary functions of the Na+/H+ exchanger have been related to many pathophysiological states, include hypertension, organ growth and hypertrophy, regression of cancer and renal intestinal disorders. At least 7 NHE isoforms (NHE1-7) have been cloned so far. They are all similar in their primary structure and predicted to have 10-12 transmembrane domains. The C-terminal domain of NHEs are predicted to be intracellular. NHE7 (human 725 aa, chromosome Xp11.4) is ubiquitously expressed, and predominantly localizes to the trans-golgi network. NHE7 mediates the influx of Na+ or K+ in exchange for H+. It is ~70% related to NHE6 but relatively less (~25%) homologous with other NHEs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76847
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-62091
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-59901
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP3-45440
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-53420
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-82574
Species: Hu
Applications: IHC,  IHC-P
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-56852
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15897
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-57956PEP
Species: Hu
Applications: AC

Publications for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP) (0)

There are no publications for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP) (0)

There are no reviews for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC9A7 Recombinant Protein Antigen (NBP2-57956PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC9A7 Products

Array NBP2-57956PEP

Blogs on SLC9A7

There are no specific blogs for SLC9A7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC9A7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A7