SLC6A20 Antibody - BSA Free

Western Blot: SLC6A20 Antibody [NBP2-84268] - Host: Rabbit. Target Name: SLC6A20. Sample Tissue: Human LN18 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SLC6A20 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC6A20. Peptide sequence: SQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC6A20 Antibody - BSA Free

• MGC161475
• neurotransmitter transporter RB21A
• SIT1
• sodium- and chloride-dependent transporter XTRP3
• Sodium/imino-acid transporter 1
• solute carrier family 6 (neurotransmitter transporter), member 20
• solute carrier family 6 (proline IMINO transporter), member 20
• Solute carrier family 6 member 20
• Transporter rB21A homolog
• X transporter protein 3
• XT3orphan transporter XT3
• Xtrp3

Background

SLC6A20 - solute carrier family 6 (proline IMINO transporter), member 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A20