SLC6A18 Antibody - BSA Free

Western Blot: SLC6A18 Antibody [NBP1-59903] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-59903] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Discontinued

SLC6A18 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC6A18(solute carrier family 6, member 18) The peptide sequence was selected from the middle region of SLC6A18. Peptide sequence MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A18
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SLC6A18 Antibody - BSA Free

• FLJ31236
• Sodium- and chloride-dependent transporter XTRP2
• sodium channel-like protein
• sodium-dependent neutral amino acid transporter B(0)AT3
• solute carrier family 6 (neurotransmitter transporter), member 18
• Solute carrier family 6 member 18
• solute carrier family 6, member 18
• System B(0) neutral amino acid transporter AT3
• XTRP2

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A18
• Uniprot:
  • Q96N87(Human)