SLC39A12 Antibody - BSA Free

Western Blot: SLC39A12 Antibody [NBP1-62528] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC39A12 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter), member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC39A12 Antibody - BSA Free

• bA570F3.1
• FLJ30499
• LIV-1 subfamily of ZIP zinc transporter 8
• LZT-Hs8
• MGC43205
• MGC51099
• solute carrier family 39 (metal ion transporter), member 12
• solute carrier family 39 (zinc transporter), member 12
• Solute carrier family 39 member 12
• zinc transporter ZIP12
• ZIP12
• ZIP-12
• Zrt- and Irt-like protein 12

Background

SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A12
• Uniprot:
  • Q504Y0-3(Human)