SLC36A4 Antibody - BSA Free

Western Blot: SLC36A4 Antibody [NBP2-88302] - Host: Rabbit. Target Name: SLC36A4. Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC36A4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC36A4 Antibody - BSA Free (NBP2-88302) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE SLC36A4. Peptide sequence: RPLINEQNFDGSSDEEQEQTLVPIQKHYQLDGQHGISFLQTLVHLLKGNI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC36A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC36A4 Antibody - BSA Free

• proton/amino acid transporter 4
• solute carrier family 36 (proton/amino acid symporter), member 4

Background

SLC36A4 is a gene that codes for a protein with two isoforms, measuring 504 and 369 amino acids in length, with weights of approximately 56 and 41 kDa respectively. The protein encoded by SLC36A4 functions as a sodium-independent electroneutral transporter for proline, tryptophan, and alanine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC36A4