SLC34A1 Recombinant Protein Antigen

Images

 
There are currently no images for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC34A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC34A1

Source: E. coli

Amino Acid Sequence: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC34A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17792.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC34A1 Recombinant Protein Antigen

  • FRTS2
  • Na(+)/Pi cotransporter 2A
  • Na(+)-dependent phosphate cotransporter 2A
  • naPi-2a
  • NAPI-3
  • NPT2NPHLOP1
  • NPTIIa
  • renal sodium-dependent phosphate transporter
  • SLC11
  • SLC17A2Na+-phosphate cotransporter type II
  • Sodium/phosphate cotransporter 2A
  • sodium/phosphate co-transporter
  • sodium-dependent phosphate transport protein 2A
  • Sodium-phosphate transport protein 2A
  • solute carrier family 17 (sodium phosphate), member 2
  • solute carrier family 34 (sodium phosphate), member 1
  • Solute carrier family 34 member 1

Background

The SLC34A1 gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
MAB26291
Species: Mu
Applications: IHC
AF4709
Species: Mu
Applications: IP, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-81933
Species: Hu
Applications: IHC,  IHC-P
8090-ZN
Species: Hu
Applications: EnzAct
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81013
Species: Hu
Applications: IHC,  IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE
AF1819
Species: Mu
Applications: ELISA, IHC, WB

Publications for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP) (0)

There are no publications for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP) (0)

There are no reviews for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC34A1 Products

Research Areas for SLC34A1 Recombinant Protein Antigen (NBP3-17792PEP)

Find related products by research area.

Blogs on SLC34A1.

SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis
SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC34A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC34A1