![Immunohistochemistry-Paraffin: SLC2A7 Antibody [NBP1-81821] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.](http://images.novusbio.com/fullsize/SLC2A7-Antibody-Immunohistochemistry-Paraffin-NBP1-81821-img0006.jpg "Immunohistochemistry-Paraffin: SLC2A7 Antibody [NBP1-81821] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVVNTPHKVFKSFYNETYFERHATFMDGKLM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC2A7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-81821 | Applications | Species |
|---|---|---|
| Sandrin Gauer J. Effect of polyphenols on sugar transport by human GLUT2, GLUT5 and GLUT7. Thesis 2017-01-01 (ICC/IF, WB, Human) | ICC/IF, WB | Human |
| Gauer JS, Tumova S, Lippiat JD et al. Differential patterns of inhibition of the sugar transporters GLUT2, GLUT5 and GLUT7 by flavonoids. Biochem Pharmacol 2018-06-01 [PMID: 29548810] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Simple Western | Human | 06/29/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 06/29/2016 |
||
| Application: | Simple Western | |
| Species: | Human |
| Gene Symbol | SLC2A7 |
![Simple Western: SLC2A7 Antibody [NBP1-81821] - Simple Western analysis of SLC2A7 in TC7 cells using SLC2A7 antibody. Cells were untreated or treated with Rapid PNGase F. Note: Deglycosylation of the protein is necessary to enhance the detection in Simple Western. Image from verified customer review.](http://images.novusbio.com/fullsize/SLC2A7-Antibody-Simple-Western-NBP1-81821-img0005.jpg "Simple Western: SLC2A7 Antibody [NBP1-81821] - Simple Western analysis of SLC2A7 in TC7 cells using SLC2A7 antibody. Cells were untreated or treated with Rapid PNGase F. Note: Deglycosylation of the protein is necessary to enhance the detection in Simple Western. Image from verified customer review.")
![Flow Cytometry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Flow_Cytometry_19979.jpg)
![Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Immunocytochemistry__Immunofluorescence_20431.jpg)
