SLC2A7 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC2A7 Antibody [NBP1-81821] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
Simple Western: SLC2A7 Antibody [NBP1-81821] - Simple Western analysis of SLC2A7 in TC7 cells using SLC2A7 antibody. Cells were untreated or treated with Rapid PNGase F. Note: Deglycosylation of the protein is necessary ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC2A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVVNTPHKVFKSFYNETYFERHATFMDGKLM
Specificity
Specificity of human SLC2A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC2A7 Protein (NBP1-81821PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-81821 in the following applications:

Publications
Read Publication using
NBP1-81821 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC2A7 Antibody

  • GLUT-7
  • GLUT7Glucose transporter type 7
  • intestinal facilitative glucose transporter 7
  • solute carrier family 2 (facilitated glucose transporter), member 7
  • solute carrier family 2, facilitated glucose transporter member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47980
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-33382
Species: Hu
Applications: IHC, IHC-P
H00144195-R01
Species: Hu
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65282
Species: Hu
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83245
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-81821
Species: Hu
Applications: Simple Western, IHC, IHC-P

Publications for SLC2A7 Antibody (NBP1-81821)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-81821 Applications Species
Sandrin Gauer J. Effect of polyphenols on sugar transport by human GLUT2, GLUT5 and GLUT7. Thesis 2017 (ICC/IF, WB, Human) ICC/IF, WB Human

Review for SLC2A7 Antibody (NBP1-81821) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81821:
Filter by Applications
Simple Western
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western SLC2A7 NBP1-81821
Enlarge
reviewed by:
Anonymous
Simple Western Human 06/29/2016
View

Summary

ApplicationSimple Western
Sample TestedTC7/Caco2 cell lysate
SpeciesHuman
LotA104482

Blocking

Blocking DetailsAntibody Diluent (ProteinSimple), 5 min, RT

Primary Anitbody

Dilution Ratio1:10 in Antibody diluent (ProteinSImple), 30 min RT,

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#042-206 (ProteinSimple)
Secondary ConcentrationNeat

Details

Detection NotesChemiluminescence (luminol/peroxide), multiimage analysis (5s-480s). Shift from ~58 kDa to ~47kDa peak after deglycosylation.

Comments

CommentsSince the antibody is targeting glycosylated epitope, it is essential to deglycosylate the protein to enhance the detection in Simple Western. Gluts are generally prone to aggregation and so the deglycosylation (15 min) as well as denaturation (10 min) were performed at 37oC.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC2A7 Antibody (NBP1-81821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC2A7 Antibody (NBP1-81821)

Discover related pathways, diseases and genes to SLC2A7 Antibody (NBP1-81821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC2A7 Antibody (NBP1-81821)

Discover more about diseases related to SLC2A7 Antibody (NBP1-81821).
 

Pathways for SLC2A7 Antibody (NBP1-81821)

View related products by pathway.

Blogs on SLC2A7

There are no specific blogs for SLC2A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
06/29/2016
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol SLC2A7