SLC2A7 Antibody


Immunohistochemistry-Paraffin: SLC2A7 Antibody [NBP1-81821] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
Simple Western: SLC2A7 Antibody [NBP1-81821] - Simple Western analysis of SLC2A7 in TC7 cells using SLC2A7 antibody. Cells were untreated or treated with Rapid PNGase F. Note: Deglycosylation of the protein is necessary more

Product Details

Reactivity HuSpecies Glossary
Applications Simple Western, IHC, IHC-P

Order Details

SLC2A7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SVVNTPHKVFKSFYNETYFERHATFMDGKLM
Specificity of human SLC2A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Simple Western
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC2A7 Protein (NBP1-81821PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-81821 in the following applications:

Read Publication using
NBP1-81821 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC2A7 Antibody

  • GLUT-7
  • GLUT7Glucose transporter type 7
  • intestinal facilitative glucose transporter 7
  • solute carrier family 2 (facilitated glucose transporter), member 7
  • solute carrier family 2, facilitated glucose transporter member 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
Species: Hu
Applications: Simple Western, IHC, IHC-P

Publications for SLC2A7 Antibody (NBP1-81821)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-81821 Applications Species
Sandrin Gauer J. Effect of polyphenols on sugar transport by human GLUT2, GLUT5 and GLUT7. Thesis 2017 (ICC/IF, WB, Human) ICC/IF, WB Human

Review for SLC2A7 Antibody (NBP1-81821) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81821:
Filter by Applications
Simple Western
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Simple Western SLC2A7 NBP1-81821
reviewed by:
Simple Western Human 06/29/2016


ApplicationSimple Western
Sample TestedTC7/Caco2 cell lysate


Blocking DetailsAntibody Diluent (ProteinSimple), 5 min, RT

Primary Anitbody

Dilution Ratio1:10 in Antibody diluent (ProteinSImple), 30 min RT,

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#042-206 (ProteinSimple)
Secondary ConcentrationNeat


Detection NotesChemiluminescence (luminol/peroxide), multiimage analysis (5s-480s). Shift from ~58 kDa to ~47kDa peak after deglycosylation.


CommentsSince the antibody is targeting glycosylated epitope, it is essential to deglycosylate the protein to enhance the detection in Simple Western. Gluts are generally prone to aggregation and so the deglycosylation (15 min) as well as denaturation (10 min) were performed at 37oC.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC2A7 Antibody (NBP1-81821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC2A7 Products

Bioinformatics Tool for SLC2A7 Antibody (NBP1-81821)

Discover related pathways, diseases and genes to SLC2A7 Antibody (NBP1-81821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC2A7 Antibody (NBP1-81821)

Discover more about diseases related to SLC2A7 Antibody (NBP1-81821).

Pathways for SLC2A7 Antibody (NBP1-81821)

View related products by pathway.

Blogs on SLC2A7

There are no specific blogs for SLC2A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: Simple Western
Species: Human


Gene Symbol SLC2A7