SLC25A43 Antibody - BSA Free

Western Blot: SLC25A43 Antibody [NBP2-83545] - Host: Rabbit. Target Name: SLC25A43. Sample Tissue: Mouse Liver lysates. Antibody Dilution: 1ug/ml

Product Discontinued

SLC25A43 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SLC25A43. Peptide sequence: HLQNFANVCVAAAVSQTLSFPFDTVKRKMQAQSPYLPHYGGVDVHFSGAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A43
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC25A43 Antibody - BSA Free

• solute carrier family 25 member 43
• solute carrier family 25, member 43

Background

SLC25A43 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A43