SLC25A35 Antibody

Images

 
Western Blot: SLC25A35 Antibody [NBP2-85742] - Host: Rabbit. Target Name: SLC25A35. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: SLC25A35 Antibody [NBP2-85742] - Host: Rabbit. Target: SLC25A35. Positive control (+): Mouse Small Intesine (M-IN). Negative control (-): Rat Liver (R-LI). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A35 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SLC25A35. Peptide sequence: QAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSST The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Guinea Pig (93%), Rabbit (100%), Zebrafish (91%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A35 Antibody

  • FLJ40217
  • MGC120446
  • MGC120448
  • solute carrier family 25 member 35
  • solute carrier family 25, member 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59607
Species: Hu
Applications: WB
NBP1-91570
Species: Hu
Applications: WB
NBP2-98610
Species: Hu
Applications: IHC, IHC-P
NBP2-30521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59566
Species: Hu
Applications: WB
NBP1-59559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055972-B01P
Species: Hu
Applications: WB
NBP1-80527
Species: Hu
Applications: WB
NBP1-59565
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-85742
Species: Hu, Mu, Rt, Po, Ca, Eq, Gp, Rb, Ze
Applications: WB

Publications for SLC25A35 Antibody (NBP2-85742) (0)

There are no publications for SLC25A35 Antibody (NBP2-85742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A35 Antibody (NBP2-85742) (0)

There are no reviews for SLC25A35 Antibody (NBP2-85742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A35 Antibody (NBP2-85742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A35 Products

Bioinformatics Tool for SLC25A35 Antibody (NBP2-85742)

Discover related pathways, diseases and genes to SLC25A35 Antibody (NBP2-85742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A35 Antibody (NBP2-85742)

Discover more about diseases related to SLC25A35 Antibody (NBP2-85742).
 

Pathways for SLC25A35 Antibody (NBP2-85742)

View related products by pathway.

Blogs on SLC25A35

There are no specific blogs for SLC25A35, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A35