SLC25A24 Antibody (2C4) - Azide and BSA Free

Sandwich ELISA: SLC25A24 Antibody (2C4) [H00029957-M01] - Detection limit for recombinant GST tagged SLC25A24 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC25A24 Antibody (2C4) - Azide and BSA Free Summary

• Immunogen: SLC25A24 (NP_037518.2, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTT
• Specificity: SLC25A24 - solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 (2C4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC25A24
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A24 Antibody (2C4) - Azide and BSA Free

• APC1calcium-binding mitochondrial carrier protein SCaMC-1
• calcium-binding transporter
• DKFZp586G0123
• MCSC1
• Mitochondrial ATP-Mg/Pi carrier protein 1
• mitochondrial ATP-Mg/Pi transporter
• Mitochondrial Ca(2+)-dependent solute carrier protein 1
• SCAMC1
• SCAMC-1
• short calcium-binding mitochondrial carrier 1
• Small calcium-binding mitochondrial carrier protein 1
• solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
• Solute carrier family 25 member 24

Background

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A24
• Entrez:
  • 29957(Human)
• Uniprot:
  • NP_037518(Human)