Recombinant Human SIRP beta 1/CD172b GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human SIRP beta 1/CD172b Protein [H00010326-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SIRP beta 1/CD172b GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-181 of Human SIRPB1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SIRPB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
45.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIRP beta 1/CD172b GST (N-Term) Protein

  • CD172 antigen-like family member B
  • CD172b antigen
  • CD172b
  • DKFZp686A05192
  • FLJ26614
  • signal-regulatory protein beta 1
  • signal-regulatory protein beta-1
  • SIRP beta 1
  • SIRPB1
  • SIRP-beta-1 isoform 3
  • SIRP-BETA-1

Background

The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65530
Species: Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
MAB5240
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-31106
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF4486
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB97861
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-67321
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP1-85959
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
D6050
Species: Hu
Applications: ELISA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00010326-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01) (0)

There are no publications for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01) (0)

There are no reviews for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIRP beta 1/CD172b Products

Bioinformatics Tool for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01)

Discover related pathways, diseases and genes to SIRP beta 1/CD172b Recombinant Protein (H00010326-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01)

Discover more about diseases related to SIRP beta 1/CD172b Recombinant Protein (H00010326-P01).
 

Pathways for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01)

View related products by pathway.

PTMs for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01)

Learn more about PTMs related to SIRP beta 1/CD172b Recombinant Protein (H00010326-P01).
 

Research Areas for SIRP beta 1/CD172b Recombinant Protein (H00010326-P01)

Find related products by research area.

Blogs on SIRP beta 1/CD172b

There are no specific blogs for SIRP beta 1/CD172b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIRP beta 1/CD172b GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRPB1