SHROOM1 Antibody


Immunocytochemistry/ Immunofluorescence: SHROOM1 Antibody [NBP2-32696] - Staining of human cell line CACO-2 shows localization to vesicles.
Immunohistochemistry: SHROOM1 Antibody [NBP2-32696] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SHROOM1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
Specificity of human SHROOM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHROOM1 Protein (NBP2-32696PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SHROOM1 Antibody

  • Apical Protein 2
  • APXL2
  • KIAA1960
  • Protein Shroom1
  • Shroom Family Member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SHROOM1 Antibody (NBP2-32696) (0)

There are no publications for SHROOM1 Antibody (NBP2-32696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHROOM1 Antibody (NBP2-32696) (0)

There are no reviews for SHROOM1 Antibody (NBP2-32696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHROOM1 Antibody (NBP2-32696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SHROOM1 Products

Diseases for SHROOM1 Antibody (NBP2-32696)

Discover more about diseases related to SHROOM1 Antibody (NBP2-32696).

Pathways for SHROOM1 Antibody (NBP2-32696)

View related products by pathway.

Blogs on SHROOM1

There are no specific blogs for SHROOM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SHROOM1 Antibody and receive a gift card or discount.