SHROOM1 Antibody

Images

 
Immunohistochemistry: SHROOM1 Antibody [NBP2-32696] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHROOM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRDDLGHHAPSPSPARPPGTCPPVQPPFPLLLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHROOM1 Protein (NBP2-32696PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHROOM1 Antibody

  • Apical Protein 2
  • APXL2
  • KIAA1960
  • Protein Shroom1
  • Shroom Family Member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13308
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93596
Species: Hu
Applications: IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-32696
Species: Hu
Applications: IHC, IHC-P

Publications for SHROOM1 Antibody (NBP2-32696) (0)

There are no publications for SHROOM1 Antibody (NBP2-32696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHROOM1 Antibody (NBP2-32696) (0)

There are no reviews for SHROOM1 Antibody (NBP2-32696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHROOM1 Antibody (NBP2-32696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHROOM1 Products

Diseases for SHROOM1 Antibody (NBP2-32696)

Discover more about diseases related to SHROOM1 Antibody (NBP2-32696).
 

Pathways for SHROOM1 Antibody (NBP2-32696)

View related products by pathway.

Blogs on SHROOM1

There are no specific blogs for SHROOM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHROOM1 Antibody and receive a gift card or discount.