SH3MD2 Recombinant Protein Antigen

Images

 
There are currently no images for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SH3MD2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3MD2

Source: E.coli

Amino Acid Sequence: AVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SH3RF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68988. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SH3MD2 Recombinant Protein Antigen

  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA1494SH3 multiple domains protein 2
  • Plenty of SH3s
  • POSHFLJ21602
  • Protein POSH
  • putative E3 ubiquitin-protein ligase SH3RF1
  • RING finger protein 142
  • RNF142plenty of SH3 domains
  • SH3 domain containing ring finger 1
  • SH3 domain-containing RING finger protein 1
  • SH3 multiple domains 2
  • SH3MD2

Background

SH3MD2 encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF4559
Species: Hu
Applications: WB
NBP1-81272
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-68888
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB

Publications for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP) (0)

There are no publications for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP) (0)

There are no reviews for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SH3MD2 Products

Bioinformatics Tool for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP)

Discover related pathways, diseases and genes to SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP)

Discover more about diseases related to SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP).
 

Pathways for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP)

View related products by pathway.

PTMs for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP)

Learn more about PTMs related to SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP).
 

Research Areas for SH3MD2 Recombinant Protein Antigen (NBP2-68988PEP)

Find related products by research area.

Blogs on SH3MD2

There are no specific blogs for SH3MD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Alix Antibody
NBP1-90201

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SH3MD2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3RF1