SH3BGRL Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SH3BGRL Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH3BGRL
  
  

  Source: E.coli

  Amino Acid Sequence: IKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SH3BGRL
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25135It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SH3BGRL Recombinant Protein Antigen

• MGC117402
• SH3 domain binding glutamic acid-rich protein like
• SH3 domain-binding glutamic acid-rich-like protein
• SH3BGR
• SH3-binding domain glutamic acid-rich protein like

Background

SH3BGRL is a gene that codes for a protein measuring 114 amino acids in length and approximately 13 kDa in weight that functions as a SH3 domain-binding glutamic acid-rich-like protein. Current studies are being done on diseases and disorders linked to this gene including endocarditis and obesity. SH3BGRL has also been shown to have interactions with EGFR, ATG5, ERBB2, IL7R, and TPT1 in pathways such as the EGFR1 signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SH3BGRL