SFRS14 Antibody (3C5)

Images

 
Western Blot: SFRS14 Antibody (3C5) [H00010147-M01] - SFRS14 monoclonal antibody (M01), clone 3C5 Analysis of SFRS14 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: SFRS14 Antibody (3C5) [H00010147-M01] - Analysis of monoclonal antibody to SFRS14 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SFRS14 Antibody (3C5) [H00010147-M01] - Analysis of monoclonal antibody to SFRS14 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: SFRS14 Antibody (3C5) [H00010147-M01] - Detection limit for recombinant GST tagged SFRS14 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SFRS14 Antibody (3C5) Summary

Immunogen
SFRS14 (NP_055699, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKL
Specificity
SFRS14 (3C5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SUGP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Control
HeLa Nuclear Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SFRS14 Antibody (3C5)

  • Arginine/serine-rich-splicing factor 14
  • DKFZp686M2322
  • DKFZp779L2418
  • KIAA0365arginine/serine-rich 14 splicing factor
  • putative splicing factor, arginine/serine-rich 14
  • SFRS14
  • Splicing factor, arginine/serine-rich 14FLJ21855
  • SRFS14
  • SURP and G patch domain containing 2
  • SURP and G-patch domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88000
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-1761
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-55245
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP3-03747
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-333
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for SFRS14 Antibody (H00010147-M01) (0)

There are no publications for SFRS14 Antibody (H00010147-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS14 Antibody (H00010147-M01) (0)

There are no reviews for SFRS14 Antibody (H00010147-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS14 Antibody (H00010147-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional SFRS14 Products

Bioinformatics Tool for SFRS14 Antibody (H00010147-M01)

Discover related pathways, diseases and genes to SFRS14 Antibody (H00010147-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS14

There are no specific blogs for SFRS14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS14 Antibody (3C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGP2
Entrez
OMIM
Uniprot