Recombinant Human Serum Amyloid A4 Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human SAA4 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
SAA4 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Serum Amyloid A4 Protein
Background
SAA4( AAH07026, 1 a.a. - 131 a.a.) recombinant protein with GST.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Serum Amyloid A4 Recombinant Protein (H00006291-P01) (0)
There are no publications for Serum Amyloid A4 Recombinant Protein (H00006291-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Serum Amyloid A4 Recombinant Protein (H00006291-P01) (0)
There are no reviews for Serum Amyloid A4 Recombinant Protein (H00006291-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Serum Amyloid A4 Recombinant Protein (H00006291-P01) (0)
Additional Serum Amyloid A4 Products
Blogs on Serum Amyloid A4