Recombinant Human SEC31A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SEC31A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-509 of Human SEC31A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDLGKKVNFWES

Protein/Peptide Type
Recombinant Protein
Gene
SEC31A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC31A Protein

  • ABP125ABP130KIAA0905Web1-like protein
  • DKFZp686N07171
  • HSPC334
  • MGC90305
  • protein transport protein Sec31A
  • protein-transport protein SEC31
  • SEC31 homolog A (S. cerevisiae)
  • SEC31L1
  • SEC31-like 1 (S. cerevisiae)
  • SEC31-like 1
  • SEC31-like protein 1
  • SEC31-related protein A
  • yeast Sec31p homolog

Background

The protein encoded by this gene is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function. An immunodepletion experiment confirmed that this protein is required for ER-Golgi transport. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
NBP1-85106
Species: Hu
Applications: IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52866
Species: Hu, Mu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB

Publications for SEC31A Recombinant Protein (H00022872-P01) (0)

There are no publications for SEC31A Recombinant Protein (H00022872-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC31A Recombinant Protein (H00022872-P01) (0)

There are no reviews for SEC31A Recombinant Protein (H00022872-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC31A Recombinant Protein (H00022872-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC31A Products

Bioinformatics Tool for SEC31A Recombinant Protein (H00022872-P01)

Discover related pathways, diseases and genes to SEC31A Recombinant Protein (H00022872-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC31A Recombinant Protein (H00022872-P01)

Discover more about diseases related to SEC31A Recombinant Protein (H00022872-P01).
 

Pathways for SEC31A Recombinant Protein (H00022872-P01)

View related products by pathway.

PTMs for SEC31A Recombinant Protein (H00022872-P01)

Learn more about PTMs related to SEC31A Recombinant Protein (H00022872-P01).

Blogs on SEC31A

There are no specific blogs for SEC31A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SEC31A Antibody
NBP1-31874

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC31A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC31A