SDHD Recombinant Protein Antigen

Images

 
There are currently no images for SDHD Protein (NBP1-92372PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SDHD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SDHD.

Source: E. coli

Amino Acid Sequence: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SDHD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92372.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SDHD Recombinant Protein Antigen

  • CBT1
  • CII-4
  • cybS
  • PGL
  • PGL1
  • QPs3
  • SDH4
  • succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  • Succinate dehydrogenase complex subunit D
  • succinate dehydrogenase complex, subunit D, integral membrane protein
  • succinate dehydrogenase ubiquinone cytochrome B small subunit
  • Succinate-ubiquinone oxidoreductase cytochrome b small subunit
  • Succinate-ubiquinone reductase membrane anchor subunit

Background

SDHD is part of Complex II. Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane. Mutations in SDHD have been linked to hereditary paraganglioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-37905
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45978
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF482
Species: Mu
Applications: IHC, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92259
Species: Hu
Applications: IHC,  IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-45219
Species: Hu
Applications: ELISA, ICC/IF, IHC, IP
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-793
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NBP2-82991
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-92372PEP
Species: Hu
Applications: AC

Publications for SDHD Protein (NBP1-92372PEP) (0)

There are no publications for SDHD Protein (NBP1-92372PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDHD Protein (NBP1-92372PEP) (0)

There are no reviews for SDHD Protein (NBP1-92372PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SDHD Protein (NBP1-92372PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SDHD Products

Research Areas for SDHD Protein (NBP1-92372PEP)

Find related products by research area.

Blogs on SDHD.

HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SDHD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SDHD