SDHC Antibody [DyLight 594]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 594

SDHC Antibody [DyLight 594] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1).
  
  Sequence:
  MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SDHC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for SDHC Antibody [DyLight 594]

• Integral membrane protein CII-3
• mitochondrial
• PGL3
• QPs1
• QPs-1
• SDH3
• succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD
• succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
• succinate-ubiquinone oxidoreducatase cytochrome B large subunit

Background

SDHC encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SDHC