Recombinant Human SCRG1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SCRG1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 98 of Human SCRG1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SCRG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCRG1 Protein

  • MGC26468
  • scrapie responsive gene 1
  • scrapie responsive protein 1
  • Scrapie-responsive gene 1 protein
  • scrapie-responsive protein 1
  • SCRG-1
  • stimulator of chondrogenesis 1

Background

Scrapie-responsive gene 1 is associated with neurodegenerative changes observed in transmissible spongiform encephalopathies. It may play a role in host response to prion-associated infections. The scrapie responsive protein 1 may be partly included in the membrane or secreted by the cells due to its hydrophobic N-terminus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF2346
Species: Mu
Applications: WB, IP
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38694
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008819-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13374
Species: Hu
Applications: IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
H00011341-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SCRG1 Recombinant Protein (H00011341-P01) (0)

There are no publications for SCRG1 Recombinant Protein (H00011341-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCRG1 Recombinant Protein (H00011341-P01) (0)

There are no reviews for SCRG1 Recombinant Protein (H00011341-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCRG1 Recombinant Protein (H00011341-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00011341-P01

Bioinformatics Tool for SCRG1 Recombinant Protein (H00011341-P01)

Discover related pathways, diseases and genes to SCRG1 Recombinant Protein (H00011341-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCRG1 Recombinant Protein (H00011341-P01)

Discover more about diseases related to SCRG1 Recombinant Protein (H00011341-P01).
 

Pathways for SCRG1 Recombinant Protein (H00011341-P01)

View related products by pathway.

Research Areas for SCRG1 Recombinant Protein (H00011341-P01)

Find related products by research area.

Blogs on SCRG1

There are no specific blogs for SCRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCRG1 Antibody
NBP1-80778

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCRG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCRG1