SCN11A Recombinant Protein Antigen

Images

 
There are currently no images for SCN11A Recombinant Protein Antigen (NBP2-48665PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCN11A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCN11A.

Source: E. coli

Amino Acid Sequence: PLKKLYEPIVTTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCN11A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48665.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCN11A Recombinant Protein Antigen

  • hNaN
  • NaN
  • Nav1.9
  • Peripheral nerve sodium channel 5
  • PN5
  • SCN11A
  • SCN12A
  • SNS2
  • SNS-2
  • sodium channel, voltage-gated, type XI, alpha polypeptide
  • sodium channel, voltage-gated, type XI, alpha subunit
  • sodium channel, voltage-gated, type XII, alpha
  • voltage-gated sodium channel Nav1.9
  • Voltage-gated sodium channel subunit alpha Nav1.9
  • voltage-gated, type XII, alpha polypeptide

Background

Voltage-gated sodium channels are membrane protein complexes that play a fundamental role in generating and transmitting action potentials in neuronal cells. SCN11A (Sodium channel, voltage-gated, type XI, alpha subunit) mediates the voltage-dependent sodium ion permeability and conductance. It forms the pore of the sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant sodium channel isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47615
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP2-12904
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
NBP2-84177
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-14468
Species: Hu
Applications: IHC, IHC-P
AF1056
Species: Rt
Applications: IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB110-61010
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
267-N3
Species: Hu
Applications: BA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
DBD00
Species: Hu
Applications: ELISA
256-GF
Species: Hu
Applications: BA
NBP2-48665PEP
Species: Hu
Applications: AC

Publications for SCN11A Recombinant Protein Antigen (NBP2-48665PEP) (0)

There are no publications for SCN11A Recombinant Protein Antigen (NBP2-48665PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN11A Recombinant Protein Antigen (NBP2-48665PEP) (0)

There are no reviews for SCN11A Recombinant Protein Antigen (NBP2-48665PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCN11A Recombinant Protein Antigen (NBP2-48665PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCN11A Products

Array NBP2-48665PEP

Research Areas for SCN11A Recombinant Protein Antigen (NBP2-48665PEP)

Find related products by research area.

Blogs on SCN11A

There are no specific blogs for SCN11A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCN11A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN11A