Recombinant Human SCN11A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCN11A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1726-1791 of Human SCN11A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCN11A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCN11A Protein

  • hNaN
  • NaN
  • Nav1.9
  • Peripheral nerve sodium channel 5
  • PN5
  • SCN12A
  • SNS2
  • SNS-2
  • sodium channel, voltage-gated, type XI, alpha polypeptide
  • sodium channel, voltage-gated, type XI, alpha subunit
  • sodium channel, voltage-gated, type XII, alpha
  • voltage-gated sodium channel Nav1.9
  • Voltage-gated sodium channel subunit alpha Nav1.9
  • voltage-gated, type XII, alpha polypeptide

Background

SCN11A - sodium channel, voltage-gated, type XI, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006328-M06
Species: Hu
Applications: WB, ELISA
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-58876
Species: Hu
Applications: ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq

Publications for SCN11A Partial Recombinant Protein (H00011280-Q01) (0)

There are no publications for SCN11A Partial Recombinant Protein (H00011280-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCN11A Partial Recombinant Protein (H00011280-Q01) (0)

There are no reviews for SCN11A Partial Recombinant Protein (H00011280-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCN11A Partial Recombinant Protein (H00011280-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCN11A Products

Bioinformatics Tool for SCN11A Partial Recombinant Protein (H00011280-Q01)

Discover related pathways, diseases and genes to SCN11A Partial Recombinant Protein (H00011280-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCN11A Partial Recombinant Protein (H00011280-Q01)

Discover more about diseases related to SCN11A Partial Recombinant Protein (H00011280-Q01).
 

Pathways for SCN11A Partial Recombinant Protein (H00011280-Q01)

View related products by pathway.

PTMs for SCN11A Partial Recombinant Protein (H00011280-Q01)

Learn more about PTMs related to SCN11A Partial Recombinant Protein (H00011280-Q01).

Blogs on SCN11A

There are no specific blogs for SCN11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
SCN11A Antibody
NBP1-82600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCN11A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN11A