SCML1 Antibody

Images

 
Western Blot: SCML1 Antibody [H00006322-D01P] - Analysis of SCML1 expression in transfected 293T cell line by SCML1 polyclonal antibody.Lane 1: SCML1 transfected lysate(23.10 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SCML1 Antibody [H00006322-D01P] - Analysis of antibody to SCML1 on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCML1 Antibody Summary

Immunogen
SCML1 (NP_001032624.1, 1 a.a. - 208 a.a.) full-length human protein. MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Specificity
SCML1 - sex comb on midleg-like 1 (Drosophila),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCML1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCML1 Antibody

  • sex comb on midleg (Drosophila)-like 1
  • sex comb on midleg-like 1 (Drosophila)
  • sex comb on midleg-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45725
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45724
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00006247-B01P
Species: Hu
Applications: WB
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87239
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80811
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006322-D01P
Species: Hu
Applications: WB, ICC/IF

Publications for SCML1 Antibody (H00006322-D01P) (0)

There are no publications for SCML1 Antibody (H00006322-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML1 Antibody (H00006322-D01P) (0)

There are no reviews for SCML1 Antibody (H00006322-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCML1 Antibody (H00006322-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCML1 Products

Bioinformatics Tool for SCML1 Antibody (H00006322-D01P)

Discover related pathways, diseases and genes to SCML1 Antibody (H00006322-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCML1 Antibody (H00006322-D01P)

Discover more about diseases related to SCML1 Antibody (H00006322-D01P).
 

Pathways for SCML1 Antibody (H00006322-D01P)

View related products by pathway.

PTMs for SCML1 Antibody (H00006322-D01P)

Learn more about PTMs related to SCML1 Antibody (H00006322-D01P).

Blogs on SCML1

There are no specific blogs for SCML1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCML1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML1
Entrez
Uniprot