SCML1 Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
SCML1 (NP_001032624.1, 1 a.a. - 208 a.a.) full-length human protein. MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN |
Specificity |
SCML1 - sex comb on midleg-like 1 (Drosophila), |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
SCML1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SCML1 Antibody
Background
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB, ICC/IF
Publications for SCML1 Antibody (H00006322-B01P) (0)
There are no publications for SCML1 Antibody (H00006322-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SCML1 Antibody (H00006322-B01P) (0)
There are no reviews for SCML1 Antibody (H00006322-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SCML1 Antibody (H00006322-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SCML1 Products
Blogs on SCML1