Home » SACM1L » SACM1L Proteins » SACM1L Recombinant Protein Antigen

SACM1L Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SACM1L Protein (NBP1-81470PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

SACM1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SACM1L.

Source: E.coli

Amino Acid Sequence: VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SACM1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81470.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SACM1L Recombinant Protein Antigen

  • DKFZp686A0231
  • EC 3.1.3
  • EC 3.1.3.36
  • EC 3.1.3.77
  • KIAA0851suppressor of actin 1
  • phosphatidylinositide phosphatase SAC1
  • SAC1 suppressor of actin mutations 1-like (yeast)
  • SAC1EC 3.1.3.-
  • Suppressor of actin mutations 1-like protein

Background

Phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P. Has low activity towards PtdIns(3,5)P2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
FIG4 GST (N-Term) Pro ...
H00009896-P01
SDS-Page: Recombinant Human FIG4 Protein [H00009896-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ADCY10 Antibody
NBP3-12270
Immunohistochemistry-Paraffin: ADCY10 Antibody [NBP3-12270] - Mouse Kidney. 1:50 antibody dilution in DiluObuffer. Counter stained with Hematoxylin 20x magnification.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SEC24B Antibody
NBP3-12266
Immunohistochemistry-Paraffin: SEC24B Antibody [NBP3-12266] - Baboon Colon-NBP3-12266. 1:100 dilution in IHC Blocking Buffer. DAB (brown) straining and Hematoxylin QS (blue) counterstain. 40x magnification on Leica DM4000B. FFPE section.
Species: Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MCM3AP Antibody
NBP1-83393
Immunocytochemistry/Immunofluorescence: MCM3AP Antibody [NBP1-83393] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
INPP5F Antibody
H00022876-B01P
Western Blot: INPP5F Antibody [H00022876-B01P] - Analysis of INPP5F expression in transfected 293T cell line by INPP5F polyclonal antibody. Lane 1: INPP5F transfected lysate(124.52 KDa). Lane 2: Non-transfected lysate.
(2 Publications)
Species: Hu
Applications: WB
Recombinant Human
VPS52 GST (N-Term) Pr ...
H00006293-Q01
SDS-Page: Recombinant Human VPS52 Protein [H00006293-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Recombinant Human
SLC6A20 GST (N-Term) ...
H00054716-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
LZTFL1 Antibody
NBP2-47387
Immunocytochemistry/Immunofluorescence: LZTFL1 Antibody [NBP2-47387] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: LZTFL1 Antibody [NBP2-47387] - Staining of human testis shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Cathepsin A/Lysosomal Carboxypeptidase A was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Cathepsin A/Lysosomal Carboxypeptidase A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1049) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HNRNPC antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining of human rectum shows strong nuclear immunoreactivity in glandular and lamina propria cells.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining of human small intestine shows strong nuclear positivity in glandular epithelium and in lamina propria cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
INPP5B Antibody
NBP1-31705
Immunohistochemistry-Paraffin: INPP5B Antibody [NBP1-31705] - Paraffin-embedded Ca922 xenograft, using antibody at 1:100 dilution.
Western Blot: INPP5B Antibody [NBP1-31705] - Sample (30 ug of whole cell lysate) A: H1299 7. 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
PRB1 Antibody
NBP3-10064
Western Blot: PRB1 Antibody [NBP3-10064] - Western blot analysis of PRB1 in Human Hela Whole Cell lysates. Antibody dilution at 1ug/ml
Species: Hu
Applications: WB
SEC6 Antibody (9H5)
NBP1-97500
Western Blot: SEC6 Antibody (9H5) [NBP1-97500] - Establishment and validation of tagged exocyst subunit cell lines. Western blots with subunit specific antibodies show successful incorporation of sfGFP in both alleles (EXO70, SEC5, and SEC8), or in one allele (SEC3 and SEC6). A shRNA specific to SEC3 was used to confirm the identity of multiple bands in the blot. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-018-07467-5) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: SEC6 Antibody (9H5) [NBP1-97500] - Analysis of human tonsil tissue stained with rSec6, mAb (9H5) at 10ug/ml.
Western Blot: SEC6 Antibody (9H5) [NBP1-97500] - Analysis of pig ESK-4 cell lysate.
(6 Publications)
Species: Bv, Ca, Ch, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ye
Applications: IB, ICC/IF, IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
ARF1 Antibody (1D9)
NB300-505
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of 3T3 cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of Hela cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of MCF-7 cells compared to an isotype control (blue).
(13 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Human colon carcinoma, using RPLP2 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB

Publications for SACM1L Protein (NBP1-81470PEP) (0)

There are no publications for SACM1L Protein (NBP1-81470PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SACM1L Protein (NBP1-81470PEP) (0)

There are no reviews for SACM1L Protein (NBP1-81470PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SACM1L Protein (NBP1-81470PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SACM1L Products

Bioinformatics Tool for SACM1L Protein (NBP1-81470PEP)

Discover related pathways, diseases and genes to SACM1L Protein (NBP1-81470PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SACM1L Protein (NBP1-81470PEP)

Discover more about diseases related to SACM1L Protein (NBP1-81470PEP).

Research Areas for SACM1L Protein (NBP1-81470PEP)

Find related products by research area.

Blogs on SACM1L

There are no specific blogs for SACM1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Exosome component 10 Antibody
NBP1-32870

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SACM1L Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SACM1L