SACM1L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SACM1L Antibody [NBP2-55859] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & the Golgi apparatus.

Product Discontinued

SACM1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SACM1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SACM1L Antibody - BSA Free

• DKFZp686A0231
• EC 3.1.3
• EC 3.1.3.36
• EC 3.1.3.77
• KIAA0851suppressor of actin 1
• phosphatidylinositide phosphatase SAC1
• SAC1 suppressor of actin mutations 1-like (yeast)
• SAC1EC 3.1.3.-
• Suppressor of actin mutations 1-like protein

Background

Phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P. Has low activity towards PtdIns(3,5)P2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SACM1L