RSK4 Antibody (6F2)

Images

 
Western Blot: RSK4 Antibody (6F2) [H00027330-M02] - RPS6KA6 monoclonal antibody (M02), clone 6F2 Analysis of RPS6KA6 expression in PC-12.
Immunohistochemistry-Paraffin: RSK4 Antibody (6F2) [H00027330-M02] - Analysis of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
6F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RSK4 Antibody (6F2) Summary

Immunogen
RPS6KA6 (-, 636 a.a. ~ 746 a.a) partial recombinant protein with GST tag.RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQI LKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTF QPVLEPVAASSLAQRRSMKKRTSTGL
Specificity
RPS6KA6 - ribosomal protein S6 kinase, 90kDa, polypeptide 6
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS6KA6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human, Rat.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RSK4 Antibody (6F2)

  • EC 2.7.11
  • EC 2.7.11.1
  • p90-RSK 6
  • p90RSK6
  • pp90RSK4
  • PP90RSK4,90 kDa ribosomal protein S6 kinase 6
  • ribosomal protein S6 kinase alpha-6
  • ribosomal protein S6 kinase, 90kDa, polypeptide 6
  • Ribosomal S6 kinase 4
  • RPS6KA6
  • RSK4
  • RSK-4
  • RSK4ribosomal protein S6 kinase, 90kD, polypeptide 6
  • S6K-alpha 6
  • S6K-alpha-6

Background

RSK4 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59722
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027330-M02
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for RSK4 Antibody (H00027330-M02) (0)

There are no publications for RSK4 Antibody (H00027330-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK4 Antibody (H00027330-M02) (0)

There are no reviews for RSK4 Antibody (H00027330-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RSK4 Antibody (H00027330-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSK4 Products

Bioinformatics Tool for RSK4 Antibody (H00027330-M02)

Discover related pathways, diseases and genes to RSK4 Antibody (H00027330-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSK4 Antibody (H00027330-M02)

Discover more about diseases related to RSK4 Antibody (H00027330-M02).
 

Pathways for RSK4 Antibody (H00027330-M02)

View related products by pathway.

PTMs for RSK4 Antibody (H00027330-M02)

Learn more about PTMs related to RSK4 Antibody (H00027330-M02).
 

Research Areas for RSK4 Antibody (H00027330-M02)

Find related products by research area.

Blogs on RSK4

There are no specific blogs for RSK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSK4 Antibody (6F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA6
Entrez
OMIM
Uniprot