RPL9 Antibody (2F11)

Images

 
Western Blot: RPL9 Antibody (2F11) [H00006133-M01] - RPL9 monoclonal antibody (M01), clone 2F11 Analysis of RPL9 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: RPL9 Antibody (2F11) [H00006133-M01] - Analysis of monoclonal antibody to RPL9 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RPL9 Antibody (2F11) [H00006133-M01] - Analysis of monoclonal antibody to RPL9 on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 1 ~ 10 ug/ml.
Sandwich ELISA: RPL9 Antibody (2F11) [H00006133-M01] - Detection limit for recombinant GST tagged RPL9 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL9 Antibody (2F11) Summary

Immunogen
RPL9 (NP_000652, 93 a.a. - 191 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQAD
Specificity
RPL9 - ribosomal protein L9
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00006133-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL9 Antibody (2F11)

  • DKFZp313J1510
  • FLJ27456
  • MGC15545
  • NPC-A-16
  • ribosomal protein L9,60S ribosomal protein L9
  • RPL9P7
  • RPL9P8
  • RPL9P9

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPL9 Antibody (H00006133-M01)(2)

Reviews for RPL9 Antibody (H00006133-M01) (0)

There are no reviews for RPL9 Antibody (H00006133-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL9 Antibody (H00006133-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL9 Products

Bioinformatics Tool for RPL9 Antibody (H00006133-M01)

Discover related pathways, diseases and genes to RPL9 Antibody (H00006133-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL9 Antibody (H00006133-M01)

Discover more about diseases related to RPL9 Antibody (H00006133-M01).
 

Pathways for RPL9 Antibody (H00006133-M01)

View related products by pathway.

PTMs for RPL9 Antibody (H00006133-M01)

Learn more about PTMs related to RPL9 Antibody (H00006133-M01).

Blogs on RPL9

There are no specific blogs for RPL9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL9 Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL9
Entrez
OMIM
Uniprot