We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RPL24/RLP24 Recombinant Protein Antigen

Images

 
There are currently no images for RPL24/RLP24 Protein (NBP2-38992PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL24/RLP24 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RSL24D1.

Source: E. coli

Amino Acid Sequence: KCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RSL24D1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38992.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL24/RLP24 Recombinant Protein Antigen

  • C15orf15
  • HRP-L30-iso
  • L30
  • RLP24
  • RPL24
  • RPL24L
  • RSL24D1 ribosomal L24 domain containing 1
  • TVAS3

Background

RPL24/RLP24 encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although RPL24/RLP24 has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35377
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-45266
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-20210
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC,  IHC-P, WB
NBP2-97838
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-20212
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NBP1-76549
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25485
Species: Ca, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-94240
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00006143-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38992PEP
Species: Hu
Applications: AC

Publications for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no publications for RPL24/RLP24 Protein (NBP2-38992PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no reviews for RPL24/RLP24 Protein (NBP2-38992PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL24/RLP24 Products

Research Areas for RPL24/RLP24 Protein (NBP2-38992PEP)

Find related products by research area.

Blogs on RPL24/RLP24

There are no specific blogs for RPL24/RLP24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL24/RLP24 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RSL24D1