RPL11 Antibody - BSA Free

Immunohistochemistry-Paraffin: RPL11 Antibody [NBP3-09430] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human heart tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPL11 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL11 (NP_001186731). Peptide sequence DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPL11 Antibody - BSA Free

• cell growth-inhibiting protein 34,60S ribosomal protein L11
• CLL-associated antigen KW-12
• DBA7
• GIG34
• ribosomal protein L11

Background

RPL11, also known as 60S ribosomal protein L11, is a 20kDa 178 amino acid protein with a shorter 20kDa 177 isoform produced by alternative splicing. RPL11 is required for rRNA maturation and can be found in the nucleus. Current research is being conducted on RPL11 in relation to aplastic anemia, anemia, pneumonia, retinitis, tuberculosis, malaria and mycobacterium tuberculosis. RPL11 has been linked to the cell cycle arrest, cell proliferation, methylation and translation pathways where it interacts with RPS15A, RPS3, RPS2, RPL26 and MDM2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL11