We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ROBLD3 Recombinant Protein Antigen

Images

 
There are currently no images for ROBLD3 Protein (NBP1-87951PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ROBLD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMTOR2.

Source: E. coli

Amino Acid Sequence: RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAMTOR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87951.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROBLD3 Recombinant Protein Antigen

  • ENDAP
  • Endosomal adaptor protein p14
  • HSPC003
  • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  • Late endosomal/lysosomal Mp1-interacting protein
  • MAPBPIPRoadblock domain-containing protein 3
  • MAPKSP1 adaptor protein
  • MAPKSP1AP
  • mitogen-activated protein-binding protein-interacting protein (MAPBPIP)
  • Mitogen-activated protein-binding protein-interacting protein
  • p14Ragulator2
  • roadblock domain containing 3
  • ROBLD3

Background

The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-86784
Species: Hu
Applications: IHC,  IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-82454
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87951PEP
Species: Hu
Applications: AC

Publications for ROBLD3 Protein (NBP1-87951PEP) (0)

There are no publications for ROBLD3 Protein (NBP1-87951PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROBLD3 Protein (NBP1-87951PEP) (0)

There are no reviews for ROBLD3 Protein (NBP1-87951PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ROBLD3 Protein (NBP1-87951PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ROBLD3 Products

Research Areas for ROBLD3 Protein (NBP1-87951PEP)

Find related products by research area.

Blogs on ROBLD3

There are no specific blogs for ROBLD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ROBLD3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMTOR2